Raly Antikörper (N-Term)

Produktnummer ABIN630644

Der Kaninchen Polyklonal Anti-Raly-Antikörper wurde für WB und IHC validiert. Er ist geeignet, Raly in Proben von Human zu detektieren.

Kurzübersicht für Raly Antikörper (N-Term) (ABIN630644)

Target: Raly (RALY) (RNA-binding protein Raly (RALY))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Raly Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-Raly Antikörper

Bindungsspezifität: N-Term

Spezifität: RALY antibody was raised against the N terminal of RALY

Aufreinigung: Affinity purified

Immunogen: RALY antibody was raised using the N terminal of RALY corresponding to a region with amino acids NKNDPKSINSRVFIGNLNTALVKKSDVETIFSKYGRVAGCSVHKGYAFVQ

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RALY Blocking Peptide, (ABIN5615749), is also available for use as a blocking control in assays to test for specificity of this RALY antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RALY antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Raly

Target: Raly (RALY) (RNA-binding protein Raly (RALY))

Andere Bezeichnung: RALY

Hintergrund: In infectious mononucleosis, anti-EBNA-1 antibodies are produced which cross-react with multiple normal human proteins. The cross-reactivity is due to anti-gly/ala antibodies that cross-react with host proteins containing configurations like those in the EBNA-1 repeat. One such antigen is RALY which is a member of the heterogeneous nuclear ribonucleoprotein gene family.

Molekulargewicht: 30 kDa (MW of target protein)