FTSJ1 Antikörper

Produktnummer ABIN630633

Dieses Anti-FTSJ1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von FTSJ1 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für FTSJ1 Antikörper (ABIN630633)

Target: FTSJ1 (FtsJ RNA Methyltransferase Homolog 1 (FTSJ1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FTSJ1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FTSJ1 Antikörper

Aufreinigung: Affinity purified

Immunogen: FTSJ1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MGRTSKDKRDVYYRLAKENGWRARSAFKLLQLDKEFQLFQGVTRAVDLCA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FTSJ1 Blocking Peptide, (ABIN5613651), is also available for use as a blocking control in assays to test for specificity of this FTSJ1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FTSJ1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FTSJ1

Target: FTSJ1 (FtsJ RNA Methyltransferase Homolog 1 (FTSJ1))

Andere Bezeichnung: FTSJ1

Hintergrund: FTSJ1 is a member of the S-adenosylmethionine-binding protein family. It is a nucleolar protein and may be involved in the processing and modification of rRNA.

Molekulargewicht: 36 kDa (MW of target protein)