PNMA1 Antikörper (Middle Region)

Produktnummer ABIN630630

Produktdetails anti-PNMA1 Antikörper

Target: PNMA1 (Paraneoplastic Antigen MA1 (PNMA1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PNMA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PNMA1 antibody was raised against the middle region of PNMA1

Aufreinigung: Affinity purified

Immunogen: PNMA1 antibody was raised using the middle region of PNMA1 corresponding to a region with amino acids KSNNPAITTAECLKALEQVFGSVESSRDAQIKFLNTYQNPGEKLSAYVIR

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PNMA1 Blocking Peptide, catalog no. 33R-4658, is also available for use as a blocking control in assays to test for specificity of this PNMA1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNMA1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PNMA1

Target: PNMA1 (Paraneoplastic Antigen MA1 (PNMA1))

Andere Bezeichnung: PNMA1 (PNMA1 Produkte)

Synonyme: PNMA1 antikoerper, 5730402C15Rik antikoerper, MA1 antikoerper, PNMA family member 1 antikoerper, paraneoplastic antigen MA1 antikoerper, paraneoplastic Ma antigen 1 antikoerper, PNMA1 antikoerper, Pnma1 antikoerper

Hintergrund: PNMA1 encodes a protein that is highly restricted to the brain and testis. Anti-PNMA1 reacts mainly with subnuclear elements (including the nucleoli) and to a lesser degree the cytoplasm.

Molekulargewicht: 40 kDa (MW of target protein)