VASH1 Antikörper (N-Term)

Produktnummer ABIN630629

Der Kaninchen Polyklonal Anti-VASH1-Antikörper wurde für WB validiert. Er ist geeignet, VASH1 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für VASH1 Antikörper (N-Term) (ABIN630629)

Target: VASH1 (Vasohibin 1 (VASH1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser VASH1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-VASH1 Antikörper

Bindungsspezifität: N-Term

Spezifität: Vasohibin 1 antibody was raised against the N terminal of VASH1

Aufreinigung: Affinity purified

Immunogen: Vasohibin 1 antibody was raised using the N terminal of VASH1 corresponding to a region with amino acids ATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPER

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Vasohibin 1 Blocking Peptide, catalog no. 33R-1576, is also available for use as a blocking control in assays to test for specificity of this Vasohibin 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VASH1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu VASH1

Target: VASH1 (Vasohibin 1 (VASH1))

Andere Bezeichnung: Vasohibin 1

Hintergrund: VASH1 is the angiogenesis inhibitor. It inhibits migration, proliferation and network formation by endothelial cells as well as angiogenesis. This inhibitory effect is selective to endothelial cells as it does not affect the migration of smooth muscle cells or fibroblasts. VASH1 does not affect the proliferation of cancer cells in vitro, but inhibits tumor growth and tumor angiogenesis. It acts in an autocrine manner. VASH1 inhibits artery neointimal formation and macrophage infiltration.

Molekulargewicht: 41 kDa (MW of target protein)