MVP Antikörper (N-Term)

Produktnummer ABIN630625

Produktdetails anti-MVP Antikörper

Target: MVP (Major Vault Protein (MVP))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MVP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MVP antibody was raised against the N terminal of MVP

Aufreinigung: Affinity purified

Immunogen: MVP antibody was raised using the N terminal of MVP corresponding to a region with amino acids MATEEFIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNERVLFAPMRM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MVP Blocking Peptide, catalog no. 33R-5769, is also available for use as a blocking control in assays to test for specificity of this MVP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MVP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MVP

Target: MVP (Major Vault Protein (MVP))

Andere Bezeichnung: MVP (MVP Produkte)

Synonyme: LRP antikoerper, VAULT1 antikoerper, 2310009M24Rik antikoerper, cb771 antikoerper, wu:fb52b05 antikoerper, wu:fc02g01 antikoerper, mvp antikoerper, MGC145641 antikoerper, Tb05.45E22.810 antikoerper, major vault protein antikoerper, major vault protein L homeolog antikoerper, putative major vault protein antikoerper, MVP antikoerper, Mvp antikoerper, mvp antikoerper, mvp.L antikoerper, Tc00.1047053510353.10 antikoerper, Tb927.5.4460 antikoerper, Tb10.70.0520 antikoerper, Tb10.70.5840 antikoerper, LMJF_05_0060 antikoerper

Hintergrund: MVP is required for normal vault structure. Vaults are multi-subunit structures that may act as scaffolds for proteins involved in signal transduction. Vaults may also play a role in nucleo-cytoplasmic transport. MVP down-regulates INFG-mediated STAT1 signaling and subsequent activation of JAK. MVP down-regulates SRC activity and signaling through MAP kinases.

Molekulargewicht: 98 kDa (MW of target protein)