MVP Antikörper (N-Term)

Produktnummer ABIN630625

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch MVP in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für MVP Antikörper (N-Term) (ABIN630625)

Target: MVP (Major Vault Protein (MVP))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MVP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MVP Antikörper

Bindungsspezifität: N-Term

Spezifität: MVP antibody was raised against the N terminal of MVP

Aufreinigung: Affinity purified

Immunogen: MVP antibody was raised using the N terminal of MVP corresponding to a region with amino acids MATEEFIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNERVLFAPMRM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MVP Blocking Peptide, catalog no. 33R-5769, is also available for use as a blocking control in assays to test for specificity of this MVP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MVP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MVP

Target: MVP (Major Vault Protein (MVP))

Andere Bezeichnung: MVP

Hintergrund: MVP is required for normal vault structure. Vaults are multi-subunit structures that may act as scaffolds for proteins involved in signal transduction. Vaults may also play a role in nucleo-cytoplasmic transport. MVP down-regulates INFG-mediated STAT1 signaling and subsequent activation of JAK. MVP down-regulates SRC activity and signaling through MAP kinases.

Molekulargewicht: 98 kDa (MW of target protein)