PNMA3 Antikörper (N-Term)

Produktnummer ABIN630623

Der Kaninchen Polyklonal Anti-PNMA3-Antikörper wurde für WB validiert. Er ist geeignet, PNMA3 in Proben von Human zu detektieren.

Kurzübersicht für PNMA3 Antikörper (N-Term) (ABIN630623)

Target: PNMA3 (Paraneoplastic Antigen MA3 (PNMA3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PNMA3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PNMA3 Antikörper

Bindungsspezifität: N-Term

Spezifität: PNMA3 antibody was raised against the N terminal of PNMA3

Aufreinigung: Affinity purified

Immunogen: PNMA3 antibody was raised using the N terminal of PNMA3 corresponding to a region with amino acids QDIDYALLPREIPGKGGPWEVIVKPRNSDGEFLNRLNRFLEEERRTVSDM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PNMA3 Blocking Peptide, (ABIN5615435), is also available for use as a blocking control in assays to test for specificity of this PNMA3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNMA3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PNMA3

Target: PNMA3 (Paraneoplastic Antigen MA3 (PNMA3))

Andere Bezeichnung: PNMA3

Hintergrund: This gene is a member of the paraneoplastic antigen MA (PNMA) gene family, whose protein products share homology with retroviral Gag proteins. They are highly expressed in the brain and also in a range of tumors associated with serious neurological phenotypes. PMID:16407312 reports the presence of a functional -1 ribosomal frameshift signal (consisting of a heptanucleotide shift motif followed 3' by a pseudoknot structure) in this gene, however, the frame-shifted product has not been characterized.

Molekulargewicht: 52 kDa (MW of target protein)