GNAI1 Antikörper
-
- Target Alle GNAI1 Antikörper anzeigen
- GNAI1 (Guanine Nucleotide Binding Protein (G Protein), alpha Inhibiting Activity Polypeptide 1 (GNAI1))
-
Reaktivität
- Human, Maus, Ratte, Drosophila melanogaster
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GNAI1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- GNAI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids YQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLH
- Top Product
- Discover our top product GNAI1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GNAI1 Blocking Peptide, catalog no. 33R-10215, is also available for use as a blocking control in assays to test for specificity of this GNAI1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNAI1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GNAI1 (Guanine Nucleotide Binding Protein (G Protein), alpha Inhibiting Activity Polypeptide 1 (GNAI1))
- Andere Bezeichnung
- GNAI1 (GNAI1 Produkte)
- Synonyme
- AU046200 antikoerper, Gialpha1 antikoerper, Gnai-1 antikoerper, gnai1 antikoerper, Gi antikoerper, BPGTPB antikoerper, zgc:63957 antikoerper, guanine nucleotide binding protein (G protein), alpha inhibiting 1 antikoerper, G protein subunit alpha i1 antikoerper, guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 S homeolog antikoerper, guanine nucleotide-binding protein G(i) subunit alpha-1 antikoerper, guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 antikoerper, Gnai1 antikoerper, gnai1.S antikoerper, GNAI1 antikoerper, LOC397505 antikoerper, gnai1 antikoerper
- Hintergrund
- Guanine nucleotide-binding proteins (G proteins) form a large family of signal-transducing molecules. They are found as heterotrimers made up of alpha, beta, and gamma subunits. Members of the G protein family have been characterized most extensively on the basis of the alpha subunit, which binds guanine nucleotide, is capable of hydrolyzing GTP, and interacts with specific receptor and effector molecules. The G protein family includes Gs and Gi, the stimulatory and inhibitory GTP-binding regulators of adenylate cyclase, Go, a protein abundant in brain (GNAO1), and transducin-1 (GNAT1) and transducin-2 (GNAT2), proteins involved in phototransduction in retinal rods and cones, respectively.
- Molekulargewicht
- 40 kDa (MW of target protein)
- Pathways
- G-protein mediated Events
-