GNAI1 Antikörper

Produktnummer ABIN630620

Der Kaninchen Polyklonal anti-GNAI1 Antikörper wird verwendet zum Nachweis von GNAI1 in Proben von Human, Maus, Ratte und Drosophila melanogaster. Er wurde validiert für WB.

Kurzübersicht für GNAI1 Antikörper (ABIN630620)

Target: GNAI1 (Guanine Nucleotide Binding Protein (G Protein), alpha Inhibiting Activity Polypeptide 1 (GNAI1))

Reaktivität: Human, Maus, Ratte, Drosophila melanogaster

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GNAI1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GNAI1 Antikörper

Aufreinigung: Affinity purified

Immunogen: GNAI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids YQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GNAI1 Blocking Peptide, (ABIN936188), is also available for use as a blocking control in assays to test for specificity of this GNAI1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNAI1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GNAI1

Target: GNAI1 (Guanine Nucleotide Binding Protein (G Protein), alpha Inhibiting Activity Polypeptide 1 (GNAI1))

Andere Bezeichnung: GNAI1

Hintergrund: Guanine nucleotide-binding proteins (G proteins) form a large family of signal-transducing molecules. They are found as heterotrimers made up of alpha, beta, and gamma subunits. Members of the G protein family have been characterized most extensively on the basis of the alpha subunit, which binds guanine nucleotide, is capable of hydrolyzing GTP, and interacts with specific receptor and effector molecules. The G protein family includes Gs and Gi, the stimulatory and inhibitory GTP-binding regulators of adenylate cyclase, Go, a protein abundant in brain (GNAO1), and transducin-1 (GNAT1) and transducin-2 (GNAT2), proteins involved in phototransduction in retinal rods and cones, respectively.

Molekulargewicht: 40 kDa (MW of target protein)

Pathways: G-protein mediated Events