PIP5KL1 Antikörper (Middle Region)

Produktnummer ABIN630616

Produktdetails anti-PIP5KL1 Antikörper

Target: PIP5KL1 (Phosphatidylinositol-4-Phosphate 5-Kinase-Like 1 (PIP5KL1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PIP5KL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PIP5 KL1 antibody was raised against the middle region of PIP5 L1

Aufreinigung: Affinity purified

Immunogen: PIP5 KL1 antibody was raised using the middle region of PIP5 L1 corresponding to a region with amino acids VLDYSLLIAFQRLHEDERGPGSSLIFRTARSVQGAQSPEESRAQNRRLLP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PIP5KL1 Blocking Peptide, catalog no. 33R-9646, is also available for use as a blocking control in assays to test for specificity of this PIP5KL1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIP0 L1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PIP5KL1

Target: PIP5KL1 (Phosphatidylinositol-4-Phosphate 5-Kinase-Like 1 (PIP5KL1))

Andere Bezeichnung: PIP5KL1 (PIP5KL1 Produkte)

Synonyme: PIPKH antikoerper, bA203J24.5 antikoerper, BC028795 antikoerper, phosphatidylinositol-4-phosphate 5-kinase like 1 antikoerper, phosphatidylinositol-4-phosphate 5-kinase-like 1 antikoerper, PIP5KL1 antikoerper, Pip5kl1 antikoerper

Hintergrund: PIP5KL1 may act as a scaffold to localize and regulate type I PI(4)P 5-kinases to specific compartments within the cell, where they generate PI(4,5)P2 for actin nucleation, signaling and scaffold protein recruitment and conversion to PI(3,4,5)P3.

Molekulargewicht: 22 kDa (MW of target protein)

Pathways: Inositol Metabolic Process