EGR1 Antikörper (Middle Region)

Produktnummer ABIN630613

Produktdetails anti-EGR1 Antikörper

Target: EGR1 (Early Growth Response 1 (EGR1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EGR1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: EGR1 antibody was raised against the middle region of EGR1

Aufreinigung: Affinity purified

Immunogen: EGR1 antibody was raised using the middle region of EGR1 corresponding to a region with amino acids PSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EGR1 Blocking Peptide, catalog no. 33R-7362, is also available for use as a blocking control in assays to test for specificity of this EGR1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EGR1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EGR1

Target: EGR1 (Early Growth Response 1 (EGR1))

Andere Bezeichnung: EGR1 (EGR1 Produkte)

Synonyme: AT225 antikoerper, G0S30 antikoerper, KROX-24 antikoerper, NGFI-A antikoerper, TIS8 antikoerper, ZIF-268 antikoerper, ZNF225 antikoerper, A530045N19Rik antikoerper, ETR103 antikoerper, Egr-1 antikoerper, Krox-1 antikoerper, Krox-24 antikoerper, Krox24 antikoerper, NGF1-A antikoerper, NGFIA antikoerper, Zenk antikoerper, Zfp-6 antikoerper, Zif268 antikoerper, egr antikoerper, Ngf1 antikoerper, Ngfi antikoerper, zif-268 antikoerper, EGR1 antikoerper, EGR-1-A antikoerper, Xegr-1 antikoerper, at225 antikoerper, egr-1 antikoerper, egr1 antikoerper, g0s30 antikoerper, krox-24 antikoerper, ngfi-a antikoerper, tis8 antikoerper, znf225 antikoerper, krox24 antikoerper, wu:fj64b05 antikoerper, wu:fq25f01 antikoerper, EGR-1 antikoerper, zenk antikoerper, EGR-1-B antikoerper, egr1-a antikoerper, egr1-b antikoerper, early growth response 1 antikoerper, early growth response protein 1 (egr-1) antikoerper, early growth response 1 L homeolog antikoerper, early growth response 1 S homeolog antikoerper, EGR1 antikoerper, CNK00890 antikoerper, Egr1 antikoerper, egr1.L antikoerper, egr1 antikoerper, egr1.S antikoerper

Hintergrund: Early Growth Response Protein 1 (EGR1, Krox-24 protein, nerve growth factor-induced protein A, Transcription factor ETR103, Zinc finger protein 225) belongs to the EGR family of C2H2-type zinc-finger proteins.

Molekulargewicht: 57 kDa (MW of target protein)

Pathways: Regulation of Carbohydrate Metabolic Process, Regulation of long-term Neuronal Synaptic Plasticity