EGR1 Antikörper (Middle Region)

Produktnummer ABIN630613

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch EGR1 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für EGR1 Antikörper (Middle Region) (ABIN630613)

Target: EGR1 (Early Growth Response 1 (EGR1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EGR1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-EGR1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: EGR1 antibody was raised against the middle region of EGR1

Aufreinigung: Affinity purified

Immunogen: EGR1 antibody was raised using the middle region of EGR1 corresponding to a region with amino acids PSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EGR1 Blocking Peptide, (ABIN5613319), is also available for use as a blocking control in assays to test for specificity of this EGR1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EGR1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EGR1

Target: EGR1 (Early Growth Response 1 (EGR1))

Andere Bezeichnung: EGR1

Hintergrund: Early Growth Response Protein 1 (EGR1, Krox-24 protein, nerve growth factor-induced protein A, Transcription factor ETR103, Zinc finger protein 225) belongs to the EGR family of C2H2-type zinc-finger proteins.

Molekulargewicht: 57 kDa (MW of target protein)

Pathways: Regulation of Carbohydrate Metabolic Process, Regulation of long-term Neuronal Synaptic Plasticity