EGR1 Antikörper (Middle Region)
-
- Target Alle EGR1 Antikörper anzeigen
- EGR1 (Early Growth Response 1 (EGR1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser EGR1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- EGR1 antibody was raised against the middle region of EGR1
- Aufreinigung
- Affinity purified
- Immunogen
- EGR1 antibody was raised using the middle region of EGR1 corresponding to a region with amino acids PSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSS
- Top Product
- Discover our top product EGR1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
EGR1 Blocking Peptide, catalog no. 33R-7362, is also available for use as a blocking control in assays to test for specificity of this EGR1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EGR1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EGR1 (Early Growth Response 1 (EGR1))
- Andere Bezeichnung
- EGR1 (EGR1 Produkte)
- Hintergrund
- Early Growth Response Protein 1 (EGR1, Krox-24 protein, nerve growth factor-induced protein A, Transcription factor ETR103, Zinc finger protein 225) belongs to the EGR family of C2H2-type zinc-finger proteins.
- Molekulargewicht
- 57 kDa (MW of target protein)
- Pathways
- Regulation of Carbohydrate Metabolic Process, Regulation of long-term Neuronal Synaptic Plasticity
-