CRYBA1 Antikörper (N-Term)

Produktnummer ABIN630602

Produktdetails anti-CRYBA1 Antikörper

Target: CRYBA1 (Crystallin, beta A1 (CRYBA1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CRYBA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Crystallin Beta A1 antibody was raised against the N terminal of CRYBA1

Aufreinigung: Affinity purified

Immunogen: Crystallin Beta A1 antibody was raised using the N terminal of CRYBA1 corresponding to a region with amino acids METQAEQQELETLPTTKMAQTNPTPGSLGPWKITIYDQENFQGKRMEFTS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Crystallin Beta A1 Blocking Peptide, catalog no. 33R-5973, is also available for use as a blocking control in assays to test for specificity of this Crystallin Beta A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRYBA1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CRYBA1

Target: CRYBA1 (Crystallin, beta A1 (CRYBA1))

Andere Bezeichnung: Crystallin beta A1 (CRYBA1 Produkte)

Synonyme: CRYB1 antikoerper, CTRCT10 antikoerper, BA3/A1 antikoerper, Cryb antikoerper, BA3A1C antikoerper, beta-A3 antikoerper, cryba1 antikoerper, zgc:92688 antikoerper, CRYBA3 antikoerper, cryb1 antikoerper, zgc:92720 antikoerper, crystallin beta A1 antikoerper, crystallin, beta A1 antikoerper, crystallin, beta A1a antikoerper, crystallin beta A1 L homeolog antikoerper, crystallin, beta A1b antikoerper, CRYBA1 antikoerper, Cryba1 antikoerper, cryba1a antikoerper, cryba1.L antikoerper, cryba1 antikoerper, cryba1b antikoerper

Hintergrund: Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and then retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families, Beta-crystallins form aggregates of different sizes and are able to self-associate to form dimers or to form heterodimers with other beta-crystallins.

Molekulargewicht: 25 kDa (MW of target protein)