CBP Antikörper
-
- Target Alle CBP (CREBBP) Antikörper anzeigen
- CBP (CREBBP) (CREB Binding Protein (CREBBP))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CBP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- CREBBP antibody was raised using a synthetic peptide corresponding to a region with amino acids TPAASQALNPQAQKQVGLATSSPATSQTGPGICMNANFNQTHPGLLNSNS
- Top Product
- Discover our top product CREBBP Primärantikörper
-
anti-CREB Binding Protein (CREBBP) (C-Term) antibody
KO Validated CREBBP Reaktivität: Human WB, IF, IP, IHC (p), ICC, ChIP Wirt: Kaninchen Polyclonal unconjugated
anti-CREB Binding Protein (CREBBP) (C-Term) antibodyCREBBP Reaktivität: Human, Maus, Ratte WB, IHC, ELISA, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-CREB Binding Protein (CREBBP) (AA 951-1050) antibodyCREBBP Reaktivität: Human WB, ELISA, IF, PLA Wirt: Maus Monoclonal 2H5 unconjugated
anti-CREB Binding Protein (CREBBP) (AA 1000-1100) antibody (Atto 594)CREBBP Reaktivität: Human WB, IHC Wirt: Kaninchen Polyclonal Atto 594
anti-CREB Binding Protein (CREBBP) (AA 1000-1100) antibody (Atto 390)CREBBP Reaktivität: Human WB, IHC Wirt: Kaninchen Polyclonal Atto 390
anti-CREB Binding Protein (CREBBP) (AA 1000-1100) antibody (HRP)CREBBP Reaktivität: Human WB, IHC Wirt: Kaninchen Polyclonal HRP
anti-CREB Binding Protein (CREBBP) (AA 1000-1100) antibody (FITC)CREBBP Reaktivität: Human WB, IHC Wirt: Kaninchen Polyclonal FITC
anti-CREB Binding Protein (CREBBP) (AA 1000-1100) antibody (Biotin)CREBBP Reaktivität: Human WB, IHC Wirt: Kaninchen Polyclonal Biotin
anti-CREB Binding Protein (CREBBP) (AA 1000-1100) antibody (PE)CREBBP Reaktivität: Human WB, IHC Wirt: Kaninchen Polyclonal PE
anti-CREB Binding Protein (CREBBP) (AA 144-193) antibodyCREBBP Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Huhn, Meerschweinchen, Pferd, Kaninchen WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CREBBP Blocking Peptide, catalog no. 33R-9216, is also available for use as a blocking control in assays to test for specificity of this CREBBP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CREBBP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CBP (CREBBP) (CREB Binding Protein (CREBBP))
- Andere Bezeichnung
- CREBBP (CREBBP Produkte)
- Synonyme
- CBP antikoerper, KAT3A antikoerper, RSTS antikoerper, AW558298 antikoerper, CBP/p300 antikoerper, p300/CBP antikoerper, RTS antikoerper, cbp antikoerper, crebbp antikoerper, kat3a antikoerper, rsts antikoerper, hmm291030 antikoerper, Nejire antikoerper, CREB binding protein antikoerper, CREB binding protein L homeolog antikoerper, histone acetyltransferase p300 antikoerper, CREBBP antikoerper, Crebbp antikoerper, crebbp.L antikoerper, LOC100123220 antikoerper
- Hintergrund
- CREBBP is involved in the transcriptional coactivation of many different transcription factors. First isolated as a nuclear protein that binds to cAMP-response element binding protein (CREB), this gene is now known to play critical roles in embryonic development, growth control, and homeostasis by coupling chromatin remodeling to transcription factor recognition. CREBBP has intrinsic histone acetyltransferase activity and also acts as a scaffold to stabilize additional protein interactions with the transcription complex.
- Molekulargewicht
- 261 kDa (MW of target protein)
- Pathways
- T-Zell Rezeptor Signalweg, Interferon-gamma Pathway, Stem Cell Maintenance, Chromatin Binding, Regulation of Lipid Metabolism by PPARalpha
-
