CBP Antikörper

Produktnummer ABIN630600

Dieses Anti-CBP-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von CBP in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für CBP Antikörper (ABIN630600)

Target: CBP (CREBBP) (CREB Binding Protein (CREBBP))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CBP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CBP Antikörper

Aufreinigung: Affinity purified

Immunogen: CREBBP antibody was raised using a synthetic peptide corresponding to a region with amino acids TPAASQALNPQAQKQVGLATSSPATSQTGPGICMNANFNQTHPGLLNSNS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CREBBP Blocking Peptide, (ABIN5612996), is also available for use as a blocking control in assays to test for specificity of this CREBBP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CREBBP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CBP

Target: CBP (CREBBP) (CREB Binding Protein (CREBBP))

Andere Bezeichnung: CREBBP

Hintergrund: CREBBP is involved in the transcriptional coactivation of many different transcription factors. First isolated as a nuclear protein that binds to cAMP-response element binding protein (CREB), this gene is now known to play critical roles in embryonic development, growth control, and homeostasis by coupling chromatin remodeling to transcription factor recognition. CREBBP has intrinsic histone acetyltransferase activity and also acts as a scaffold to stabilize additional protein interactions with the transcription complex.

Molekulargewicht: 261 kDa (MW of target protein)

Pathways: T-Zell Rezeptor Signalweg, Interferon-gamma Pathway, Stem Cell Maintenance, Chromatin Binding, Regulation of Lipid Metabolism by PPARalpha