MBD3 Antikörper (N-Term)

Produktnummer ABIN630599

Produktdetails anti-MBD3 Antikörper

Target: MBD3 (Methyl-CpG Binding Domain Protein 3 (MBD3))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MBD3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MBD3 antibody was raised against the N terminal of MBD3

Aufreinigung: Affinity purified

Immunogen: MBD3 antibody was raised using the N terminal of MBD3 corresponding to a region with amino acids SKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPSN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MBD3 Blocking Peptide, catalog no. 33R-8560, is also available for use as a blocking control in assays to test for specificity of this MBD3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MBD3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MBD3

Target: MBD3 (Methyl-CpG Binding Domain Protein 3 (MBD3))

Andere Bezeichnung: MBD3 (MBD3 Produkte)

Synonyme: xmbd3 antikoerper, MGC69548 antikoerper, MBD3 antikoerper, DKFZp459N1635 antikoerper, AI181826 antikoerper, AU019209 antikoerper, methyl-CpG binding domain protein 3 S homeolog antikoerper, methyl-CpG binding domain protein 3 antikoerper, mbd3.S antikoerper, mbd3 antikoerper, MBD3 antikoerper, Mbd3 antikoerper

Hintergrund: DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD).

Molekulargewicht: 33 kDa (MW of target protein)

Pathways: Chromatin Binding