HPRT1 Antikörper

Produktnummer ABIN630595

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch HPRT1 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus, Ratte und Hund.

Kurzübersicht für HPRT1 Antikörper (ABIN630595)

Target: HPRT1 (Hypoxanthine phosphoribosyltransferase 1 (HPRT1))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HPRT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-HPRT1 Antikörper

Aufreinigung: Affinity purified

Immunogen: HPRT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids STGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HPRT1 Blocking Peptide, (ABIN5614065), is also available for use as a blocking control in assays to test for specificity of this HPRT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HPRT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HPRT1

Target: HPRT1 (Hypoxanthine phosphoribosyltransferase 1 (HPRT1))

Andere Bezeichnung: HPRT1

Hintergrund: HPRT1 has a central role in the generation of purine nucleotides through the purine salvage pathway. HPRT1 catalyzes conversion of hypoxanthine to inosine monophosphate and guanine to guanosine monophosphate via transfer of the 5-phosphoribosyl group from 5-phosphoribosyl 1-pyrophosphate.

Molekulargewicht: 24 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process