GTPBP10 Antikörper

Produktnummer ABIN630593

This anti-GTPBP10 antibody (ABIN630593) is a Rabbit Polyclonal antibody detecting GTPBP10 in WB. Suitable for Human, Mouse, Rat, Drosophila melanogaster.

Kurzübersicht für GTPBP10 Antikörper (ABIN630593)

Target: GTPBP10 (GTP-Binding Protein 10 (GTPBP10))

Reaktivität: Human, Maus, Ratte, Drosophila melanogaster

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GTPBP10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GTPBP10 Antikörper

Aufreinigung: Affinity purified

Immunogen: GTPBP10 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLKLIADVGLVGFPNAGKSSLLSCVSHAKPAIADYAFTTLKPELGKIMYS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GTPBP10 Blocking Peptide, catalog no. 33R-2052, is also available for use as a blocking control in assays to test for specificity of this GTPBP10 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GTPBP10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GTPBP10

Target: GTPBP10 (GTP-Binding Protein 10 (GTPBP10))

Andere Bezeichnung: GTPBP10

Hintergrund: Small G proteins, such as GTPBP10, act as molecular switches that play crucial roles in the regulation of fundamental cellular processes such as protein synthesis, nuclear transport, membrane trafficking, and signal transduction.

Molekulargewicht: 43 kDa (MW of target protein)