PDSS2 Antikörper
-
- Target Alle PDSS2 Antikörper anzeigen
- PDSS2 (Prenyl (Decaprenyl) Diphosphate Synthase, Subunit 2 (PDSS2))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PDSS2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PDSS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids IKAGKGVTSAIDLCRYHGNKALEALESFPPSEARSALENIVFAVTRFS
- Top Product
- Discover our top product PDSS2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PDSS2 Blocking Peptide, catalog no. 33R-4010, is also available for use as a blocking control in assays to test for specificity of this PDSS2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDSS2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PDSS2 (Prenyl (Decaprenyl) Diphosphate Synthase, Subunit 2 (PDSS2))
- Andere Bezeichnung
- PDSS2 (PDSS2 Produkte)
- Synonyme
- dlp1 antikoerper, C6orf210 antikoerper, COQ10D3 antikoerper, DLP1 antikoerper, bA59I9.3 antikoerper, hDLP1 antikoerper, zgc:92156 antikoerper, 5430420P03Rik antikoerper, Gm60 antikoerper, Plmp antikoerper, kd antikoerper, mDLP1 antikoerper, decaprenyl diphosphate synthase subunit 2 antikoerper, prenyl (decaprenyl) diphosphate synthase, subunit 2 antikoerper, decaprenyl-diphosphate synthase subunit 2 antikoerper, decaprenyl diphosphate synthase subunit 2 Dlp1 antikoerper, prenyl (solanesyl) diphosphate synthase, subunit 2 antikoerper, PDSS2 antikoerper, pdss2 antikoerper, CpipJ_CPIJ016311 antikoerper, SJAG_01865 antikoerper, Tsp_08290 antikoerper, Pdss2 antikoerper
- Hintergrund
- The isoprenoid chain of ubiquinone (coenzyme Q) varies in length between species and is determined by trans-polyprenyl diphosphate synthase. Humans possess a heterotetrameric decaprenyl diphosphate synthase composed of DPS1 and DLP1 (PDSS2) that produces Q10 ubiquinone.
- Molekulargewicht
- 44 kDa (MW of target protein)
-