Tryptophan Hydroxylase 2 Antikörper (N-Term)
-
- Target Alle Tryptophan Hydroxylase 2 (TPH2) Antikörper anzeigen
- Tryptophan Hydroxylase 2 (TPH2)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Tryptophan Hydroxylase 2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TPH2 antibody was raised against the N terminal of TPH2
- Aufreinigung
- Affinity purified
- Immunogen
- TPH2 antibody was raised using the N terminal of TPH2 corresponding to a region with amino acids REAATESGKTAVVFSLKNEVGGLVKALRLFQEKRVNMVHIESRKSRRRSS
- Top Product
- Discover our top product TPH2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TPH2 Blocking Peptide, catalog no. 33R-7865, is also available for use as a blocking control in assays to test for specificity of this TPH2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPH2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Tryptophan Hydroxylase 2 (TPH2)
- Andere Bezeichnung
- TPH2 (TPH2 Produkte)
- Hintergrund
- Tryptophan hydroxylase (TPH, EC 1.14.16.4) is the rate-limiting enzyme in the synthesis of serotonin (5-hydroxytryptamine, or 5HT). 5HT is causally involved in numerous central nervous activities, and it has several functions in peripheral tissues, including the maintenance of vascular tone and gut motility.
- Molekulargewicht
- 56 kDa (MW of target protein)
-