Tryptophan Hydroxylase 2 Antikörper (N-Term)

Produktnummer ABIN630584

Der Kaninchen Polyklonal Anti-Tryptophan Hydroxylase 2-Antikörper wurde für WB validiert. Er ist geeignet, Tryptophan Hydroxylase 2 in Proben von Human und Hund zu detektieren.

Kurzübersicht für Tryptophan Hydroxylase 2 Antikörper (N-Term) (ABIN630584)

Target: Tryptophan Hydroxylase 2 (TPH2)

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Tryptophan Hydroxylase 2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Tryptophan Hydroxylase 2 Antikörper

Bindungsspezifität: N-Term

Spezifität: TPH2 antibody was raised against the N terminal of TPH2

Aufreinigung: Affinity purified

Immunogen: TPH2 antibody was raised using the N terminal of TPH2 corresponding to a region with amino acids REAATESGKTAVVFSLKNEVGGLVKALRLFQEKRVNMVHIESRKSRRRSS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TPH2 Blocking Peptide, (ABIN5616739), is also available for use as a blocking control in assays to test for specificity of this TPH2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPH2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Tryptophan Hydroxylase 2

Target: Tryptophan Hydroxylase 2 (TPH2)

Andere Bezeichnung: TPH2

Hintergrund: Tryptophan hydroxylase (TPH, EC 1.14.16.4) is the rate-limiting enzyme in the synthesis of serotonin (5-hydroxytryptamine, or 5HT). 5HT is causally involved in numerous central nervous activities, and it has several functions in peripheral tissues, including the maintenance of vascular tone and gut motility.

Molekulargewicht: 56 kDa (MW of target protein)