GUK1 Antikörper (Middle Region)

Produktnummer ABIN630582

Produktdetails anti-GUK1 Antikörper

Target: GUK1 (Guanylate Kinase 1 (GUK1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GUK1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GUK1 antibody was raised against the middle region of GUK1

Aufreinigung: Affinity purified

Immunogen: GUK1 antibody was raised using the middle region of GUK1 corresponding to a region with amino acids IEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GUK1 Blocking Peptide, catalog no. 33R-3939, is also available for use as a blocking control in assays to test for specificity of this GUK1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GUK1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GUK1

Target: GUK1 (Guanylate Kinase 1 (GUK1))

Andere Bezeichnung: GUK1 (GUK1 Produkte)

Synonyme: GMK antikoerper, AA409738 antikoerper, AL033299 antikoerper, AL033300 antikoerper, AV026611 antikoerper, Gmk antikoerper, Guk-1 antikoerper, guk1 antikoerper, zgc:73128 antikoerper, zgc:73217 antikoerper, gmk antikoerper, GUK1 antikoerper, AGK1 antikoerper, T11A7.23 antikoerper, guanylate kinase 1 antikoerper, DDBDRAFT_0215291 antikoerper, DDBDRAFT_0230100 antikoerper, DDB_0215291 antikoerper, DDB_0230100 antikoerper, sb:cb295 antikoerper, zgc:86776 antikoerper, guanylate kinase 1 antikoerper, guanylate kinase (GUK1) antikoerper, guanylate kinase antikoerper, guanylate kinase 1b antikoerper, guanylate kinase 1 L homeolog antikoerper, guanylate kinase 1a antikoerper, GUK1 antikoerper, Guk1 antikoerper, guk1b antikoerper, guk1 antikoerper, guk1.L antikoerper, GK-1 antikoerper, gmk antikoerper, gmkA antikoerper, Mrub_2093 antikoerper, Arnit_0783 antikoerper, Ndas_3097 antikoerper, Mesil_1319 antikoerper, Slip_0854 antikoerper, Olsu_0986 antikoerper, Acear_1451 antikoerper, AOR_1_2886174 antikoerper, guk1a antikoerper

Hintergrund: GUK1 is essential for recycling GMP and indirectly, cGMP.

Molekulargewicht: 22 kDa (MW of target protein)

Pathways: Nucleotide Phosphorylation, ER-Nucleus Signaling, Ribonucleoside Biosynthetic Process