TPI1 Antikörper (N-Term)

Produktnummer ABIN630577

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch TPI1 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für TPI1 Antikörper (N-Term) (ABIN630577)

Target: TPI1 (Triosephosphate Isomerase 1 (TPI1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TPI1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TPI1 Antikörper

Bindungsspezifität: N-Term

Spezifität: TPI1 antibody was raised against the N terminal of TPI1

Aufreinigung: Affinity purified

Immunogen: TPI1 antibody was raised using the N terminal of TPI1 corresponding to a region with amino acids MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYID

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TPI1 Blocking Peptide, (ABIN5616740), is also available for use as a blocking control in assays to test for specificity of this TPI1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPI1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TPI1

Target: TPI1 (Triosephosphate Isomerase 1 (TPI1))

Andere Bezeichnung: TPI1

Hintergrund: TPI1 belongs to the triosephosphate isomerase family. Defects in TPI1 are the cause of triosephosphate isomerase deficiency (TPI deficiency) . TPI deficiency is an autosomal recessive disorder. It is the most severe clinical disorder of glycolysis. It is associated with neonatal jaundice, chronic hemolytic anemia, progressive neuromuscular dysfunction, cardiomyopathy and increased susceptibility to infection.

Molekulargewicht: 27 kDa (MW of target protein)

Pathways: Cell RedoxHomeostasis