RPL30 Antikörper (Middle Region)

Produktnummer ABIN630571

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch RPL30 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für RPL30 Antikörper (Middle Region) (ABIN630571)

Target: RPL30 (Ribosomal Protein L30 (RPL30))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPL30 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RPL30 Antikörper

Bindungsspezifität: Middle Region

Spezifität: RPL30 antibody was raised against the middle region of RPL30

Aufreinigung: Affinity purified

Immunogen: RPL30 antibody was raised using the middle region of RPL30 corresponding to a region with amino acids LKMIRQGKAKLVILANNCPALRKSEIEYYAMLAKTGVHHYSGNNIELGTA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RPL30 Blocking Peptide, (ABIN940478), is also available for use as a blocking control in assays to test for specificity of this RPL30 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL30 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPL30

Target: RPL30 (Ribosomal Protein L30 (RPL30))

Andere Bezeichnung: RPL30

Hintergrund: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL30 is a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L30E family of ribosomal proteins. It is located in the cytoplasm. This gene encoding RPL30 is co-transcribed with the U72 small nucleolar RNA gene, which is located in its fourth intron.

Molekulargewicht: 13 kDa (MW of target protein)