DONSON Antikörper (Middle Region)

Produktnummer ABIN630570

Produktdetails anti-DONSON Antikörper

Target: DONSON (Downstream Neighbor of SON (DONSON))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DONSON Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DONSON antibody was raised against the middle region of DONSON

Aufreinigung: Affinity purified

Immunogen: DONSON antibody was raised using the middle region of DONSON corresponding to a region with amino acids DLITALISPTTRGLREAMRNEGIEFSLPLIKESGHKKETASGTSLGYGEE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DONSON Blocking Peptide, catalog no. 33R-2048, is also available for use as a blocking control in assays to test for specificity of this DONSON antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DONSON antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DONSON

Target: DONSON (Downstream Neighbor of SON (DONSON))

Andere Bezeichnung: DONSON (DONSON Produkte)

Synonyme: B17 antikoerper, C21orf60 antikoerper, C2TA antikoerper, 1110025J21Rik antikoerper, AI845729 antikoerper, ORF60 antikoerper, MGC76196 antikoerper, downstream neighbor of SON antikoerper, downstream neighbor of Son antikoerper, protein downstream neighbor of Son antikoerper, downstream neighbor of SON L homeolog antikoerper, DONSON antikoerper, CpipJ_CPIJ018445 antikoerper, Donson antikoerper, donson antikoerper, LOC478407 antikoerper, donson.L antikoerper

Hintergrund: This gene lies downstream of the SON gene and spans 10 kb on chromosome 21. The function of this gene is unknown.

Molekulargewicht: 63 kDa (MW of target protein)