DONSON Antikörper (Middle Region)

Produktnummer ABIN630570

Dieses Anti-DONSON-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von DONSON in WB. Geeignet für Human und Maus.

Kurzübersicht für DONSON Antikörper (Middle Region) (ABIN630570)

Target: DONSON (Downstream Neighbor of SON (DONSON))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DONSON Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DONSON Antikörper

Bindungsspezifität: Middle Region

Spezifität: DONSON antibody was raised against the middle region of DONSON

Aufreinigung: Affinity purified

Immunogen: DONSON antibody was raised using the middle region of DONSON corresponding to a region with amino acids DLITALISPTTRGLREAMRNEGIEFSLPLIKESGHKKETASGTSLGYGEE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DONSON Blocking Peptide, (ABIN937434), is also available for use as a blocking control in assays to test for specificity of this DONSON antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DONSON antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DONSON

Target: DONSON (Downstream Neighbor of SON (DONSON))

Andere Bezeichnung: DONSON

Hintergrund: This gene lies downstream of the SON gene and spans 10 kb on chromosome 21. The function of this gene is unknown.

Molekulargewicht: 63 kDa (MW of target protein)