CBR1 Antikörper (Middle Region)

Produktnummer ABIN630569

Der Kaninchen-Polyklonal Anti-CBR1-Antikörper wurde für WB validiert. Er ist geeignet zum Nachweis von CBR1 in Proben aus Human. }

Kurzübersicht für CBR1 Antikörper (Middle Region) (ABIN630569)

Target: CBR1 (Carbonyl Reductase 1 (CBR1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CBR1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CBR1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: Carbonyl Reductase 1 antibody was raised against the middle region of CBR1

Aufreinigung: Affinity purified

Immunogen: Carbonyl Reductase 1 antibody was raised using the middle region of CBR1 corresponding to a region with amino acids AEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Carbonyl Reductase 1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this Carbonyl Reductase 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CBR1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CBR1

Target: CBR1 (Carbonyl Reductase 1 (CBR1))

Andere Bezeichnung: Carbonyl Reductase 1

Hintergrund: Carbonyl reductase is one of several monomeric, NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds. This enzyme is widely distributed in human tissues.

Molekulargewicht: 30 kDa (MW of target protein)