TSPY-Like 6 Antikörper (N-Term)

Produktnummer ABIN630567

Produktdetails anti-TSPY-Like 6 Antikörper

Target: TSPY-Like 6 (TSPYL6)

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TSPY-Like 6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TSPYL6 antibody was raised against the N terminal of TSPYL6

Aufreinigung: Affinity purified

Immunogen: TSPYL6 antibody was raised using the N terminal of TSPYL6 corresponding to a region with amino acids MSLPESPHSPATLDYALEDPHQGQRSREKSKATEVMADMFDGRLEPIVFP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TSPYL6 Blocking Peptide, catalog no. 33R-6465, is also available for use as a blocking control in assays to test for specificity of this TSPYL6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPYL6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TSPY-Like 6

Target: TSPY-Like 6 (TSPYL6)

Andere Bezeichnung: TSPYL6 (TSPYL6 Produkte)

Synonyme: TSPY like 6 antikoerper, TSPYL6 antikoerper

Hintergrund: The function of TSPYL6 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 46 kDa (MW of target protein)