TSPY-Like 6 Antikörper (N-Term)

Produktnummer ABIN630567

Dieses Anti-TSPY-Like 6-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von TSPY-Like 6 in WB. Geeignet für Human.

Kurzübersicht für TSPY-Like 6 Antikörper (N-Term) (ABIN630567)

Target: TSPY-Like 6 (TSPYL6)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TSPY-Like 6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TSPY-Like 6 Antikörper

Bindungsspezifität: N-Term

Spezifität: TSPYL6 antibody was raised against the N terminal of TSPYL6

Aufreinigung: Affinity purified

Immunogen: TSPYL6 antibody was raised using the N terminal of TSPYL6 corresponding to a region with amino acids MSLPESPHSPATLDYALEDPHQGQRSREKSKATEVMADMFDGRLEPIVFP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TSPYL6 Blocking Peptide, (ABIN5616829), is also available for use as a blocking control in assays to test for specificity of this TSPYL6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPYL6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TSPY-Like 6

Target: TSPY-Like 6 (TSPYL6)

Andere Bezeichnung: TSPYL6

Hintergrund: The function of TSPYL6 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 46 kDa (MW of target protein)