CRYM Antikörper (Middle Region)

Produktnummer ABIN630565

Produktdetails anti-CRYM Antikörper

Target: CRYM (Crystallin, mu (CRYM))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CRYM Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Crystallin Mu antibody was raised against the middle region of CRYM

Aufreinigung: Affinity purified

Immunogen: Crystallin Mu antibody was raised using the middle region of CRYM corresponding to a region with amino acids AHINAVGASRPDWRELDDELMKEAVLYVDSQEAALKESGDVLLSGAEIFA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Crystallin Mu Blocking Peptide, catalog no. 33R-1248, is also available for use as a blocking control in assays to test for specificity of this Crystallin Mu antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRYM antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CRYM

Target: CRYM (Crystallin, mu (CRYM))

Andere Bezeichnung: Crystallin mu (CRYM Produkte)

Synonyme: CRYM antikoerper, zgc:158843 antikoerper, DFNA40 antikoerper, THBP antikoerper, crystallin mu antikoerper, crystallin, mu antikoerper, Cro/Cl family transcriptional regulator antikoerper, crystallin mu L homeolog antikoerper, CRYM antikoerper, crym antikoerper, EAMY_RS27495 antikoerper, crym.L antikoerper, Crym antikoerper

Hintergrund: Crystallins are separated into two classes: taxon-specific and ubiquitous. The former class is also called phylogenetically-restricted crystallins. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. This gene encodes a taxon-specific crystallin protein that binds NADPH and has sequence similarity to bacterial ornithine cyclodeaminases.

Molekulargewicht: 30 kDa (MW of target protein)

Pathways: Hormone Transport, Sensory Perception of Sound