RRP1B Antikörper

Produktnummer ABIN630542

Produktdetails anti-RRP1B Antikörper

Target: RRP1B (Ribosomal RNA Processing 1 Homolog B (RRP1B))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RRP1B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: RRP1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids VTFGLNRNMTAEFKKTDKSILVSPTGPSRVAFDPEQKPLHGVLKTPTSSP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RRP1B Blocking Peptide, catalog no. 33R-9842, is also available for use as a blocking control in assays to test for specificity of this RRP1B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RRP0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RRP1B

Target: RRP1B (Ribosomal RNA Processing 1 Homolog B (RRP1B))

Andere Bezeichnung: RRP1B (RRP1B Produkte)

Synonyme: 2600005C20Rik antikoerper, D030064A17 antikoerper, Kiaa0179 antikoerper, mKIAA0179 antikoerper, KIAA0179 antikoerper, NNP1L antikoerper, Nnp1 antikoerper, RRP1 antikoerper, RGD1305633 antikoerper, ribosomal RNA processing 1B antikoerper, ribosomal RNA processing 1 homolog B (S. cerevisiae) antikoerper, ribosomal RNA processing 1B L homeolog antikoerper, RRP1B antikoerper, Rrp1b antikoerper, rrp1b.L antikoerper

Hintergrund: RRP1B belongs to the RRP1 family. It may be a novel susceptibility gene for breast cancer progression and metastasis.

Molekulargewicht: 84 kDa (MW of target protein)