RRP1B Antikörper

Produktnummer ABIN630542

Der Kaninchen Polyklonal Anti-RRP1B-Antikörper wurde für WB validiert. Er ist geeignet, RRP1B in Proben von Human zu detektieren.

Kurzübersicht für RRP1B Antikörper (ABIN630542)

Target: RRP1B (Ribosomal RNA Processing 1 Homolog B (RRP1B))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RRP1B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RRP1B Antikörper

Aufreinigung: Affinity purified

Immunogen: RRP1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids VTFGLNRNMTAEFKKTDKSILVSPTGPSRVAFDPEQKPLHGVLKTPTSSP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RRP1B Blocking Peptide, (ABIN5615964), is also available for use as a blocking control in assays to test for specificity of this RRP1B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RRP0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RRP1B

Target: RRP1B (Ribosomal RNA Processing 1 Homolog B (RRP1B))

Andere Bezeichnung: RRP1B

Hintergrund: RRP1B belongs to the RRP1 family. It may be a novel susceptibility gene for breast cancer progression and metastasis.

Molekulargewicht: 84 kDa (MW of target protein)