PRDM15 Antikörper (Middle Region)

Produktnummer ABIN630539

Der Kaninchen-Polyklonal Anti-PRDM15-Antikörper wurde für WB validiert. Er ist geeignet zum Nachweis von PRDM15 in Proben aus Human, Maus und Ratte. }

Kurzübersicht für PRDM15 Antikörper (Middle Region) (ABIN630539)

Target: PRDM15 (PR Domain Containing 15 (PRDM15))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PRDM15 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PRDM15 Antikörper

Bindungsspezifität: Middle Region

Spezifität: PRDM15 antibody was raised against the middle region of PRDM15

Aufreinigung: Affinity purified

Immunogen: PRDM15 antibody was raised using the middle region of PRDM15 corresponding to a region with amino acids LCGTKVSTRASMSRHMRRKHPEVLAVRIDDLDHLPETTTIDASSIGIVQP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRDM15 Blocking Peptide, (ABIN940205), is also available for use as a blocking control in assays to test for specificity of this PRDM15 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRDM15 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PRDM15

Target: PRDM15 (PR Domain Containing 15 (PRDM15))

Andere Bezeichnung: PRDM15

Hintergrund: PRDM15 may be involved in transcriptional regulation.

Molekulargewicht: 134 kDa (MW of target protein)