LOC441956 Antikörper (N-Term)

Produktnummer ABIN630537

Der Kaninchen Polyklonal anti-LOC441956 Antikörper (ABIN630537) detektiert spezifisch LOC441956 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für LOC441956 Antikörper (N-Term) (ABIN630537)

Target: LOC441956 (Hypothetical LOC441956 (LOC441956))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Applikation: Western Blotting (WB)

Produktdetails anti-LOC441956 Antikörper

Bindungsspezifität: N-Term

Spezifität: LOC441956 antibody was raised against the N terminal of LOC441956

Aufreinigung: Affinity purified

Immunogen: LOC441956 antibody was raised using the N terminal of LOC441956 corresponding to a region with amino acids APEDPASLRHGLWHQRTQPLAPWTMAAEDPAPRILDYGSRGPSLPASWTK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LOC441956 Blocking Peptide, (ABIN936804), is also available for use as a blocking control in assays to test for specificity of this LOC441956 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LOC441956 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LOC441956

Target: LOC441956 (Hypothetical LOC441956 (LOC441956))

Andere Bezeichnung: LOC441956

Hintergrund: The function of LOC441956 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 15 kDa (MW of target protein)