PAX8 Antikörper (N-Term)
-
- Target Alle PAX8 Antikörper anzeigen
- PAX8 (Paired Box 8 (PAX8))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PAX8 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PAX8 antibody was raised against the N terminal of PAX8
- Aufreinigung
- Affinity purified
- Immunogen
- PAX8 antibody was raised using the N terminal of PAX8 corresponding to a region with amino acids KSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDD
- Top Product
- Discover our top product PAX8 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PAX8 Blocking Peptide, catalog no. 33R-4656, is also available for use as a blocking control in assays to test for specificity of this PAX8 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAX8 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PAX8 (Paired Box 8 (PAX8))
- Andere Bezeichnung
- PAX8 (PAX8 Produkte)
- Synonyme
- PAX8 antikoerper, XPax-8 antikoerper, XPax8 antikoerper, pax-8 antikoerper, PAX-8 antikoerper, Pax-8 antikoerper, paired box 8 antikoerper, paired box 8 L homeolog antikoerper, PAX8 antikoerper, pax8 antikoerper, Pax8 antikoerper, pax8.L antikoerper
- Hintergrund
- PAX8 is a member of the paired box (PAX) family of transcription factors. Members of this family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. This nuclear protein is involved in thyroid follicular cell development and expression of thyroid-specific genes. Mutations in its gene have been associated with thyroid dysgenesis, thyroid follicular carcinomas and atypical follicular thyroid adenomas.
- Molekulargewicht
- 48 kDa (MW of target protein)
- Pathways
- Thyroid Hormone Synthesis, Regulation of Hormone Metabolic Process, Stem Cell Maintenance, Tube Formation
-