PAX8 Antikörper (N-Term)

Produktnummer ABIN630533

Der Kaninchen Polyklonal Anti-PAX8-Antikörper wurde für WB validiert. Er ist geeignet, PAX8 in Proben von Human, Maus, Ratte und Hund zu detektieren.

Kurzübersicht für PAX8 Antikörper (N-Term) (ABIN630533)

Target: PAX8 (Paired Box 8 (PAX8))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PAX8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PAX8 Antikörper

Bindungsspezifität: N-Term

Spezifität: PAX8 antibody was raised against the N terminal of PAX8

Aufreinigung: Affinity purified

Immunogen: PAX8 antibody was raised using the N terminal of PAX8 corresponding to a region with amino acids KSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDD

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PAX8 Blocking Peptide, (ABIN940042), is also available for use as a blocking control in assays to test for specificity of this PAX8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAX8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PAX8

Target: PAX8 (Paired Box 8 (PAX8))

Andere Bezeichnung: PAX8

Hintergrund: PAX8 is a member of the paired box (PAX) family of transcription factors. Members of this family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. This nuclear protein is involved in thyroid follicular cell development and expression of thyroid-specific genes. Mutations in its gene have been associated with thyroid dysgenesis, thyroid follicular carcinomas and atypical follicular thyroid adenomas.

Molekulargewicht: 48 kDa (MW of target protein)

Pathways: Thyroid Hormone Synthesis, Regulation of Hormone Metabolic Process, Stem Cell Maintenance, Tube Formation