C18orf54 Antikörper

Produktnummer ABIN630532

Produktdetails anti-C18orf54 Antikörper

Target: C18orf54 (Chromosome 18 Open Reading Frame 54 (C18orf54))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C18orf54 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: C18 ORF54 antibody was raised using a synthetic peptide corresponding to a region with amino acids PCSLDKLEADRSWENIPVTFKSPVPVNSDDSPQQTSRAKSAKGVLEDFLN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C18ORF54 Blocking Peptide, catalog no. 33R-7000, is also available for use as a blocking control in assays to test for specificity of this C18ORF54 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF54 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C18orf54

Target: C18orf54 (Chromosome 18 Open Reading Frame 54 (C18orf54))

Andere Bezeichnung: C18ORF54 (C18orf54 Produkte)

Synonyme: LAS2 antikoerper, 9930107F24 antikoerper, BB148262 antikoerper, Lars antikoerper, Las2 antikoerper, chromosome 18 open reading frame 54 antikoerper, RIKEN cDNA 4930503L19 gene antikoerper, c18orf54 antikoerper, C18orf54 antikoerper, 4930503L19Rik antikoerper

Hintergrund: The function of C18orf54 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 58 kDa (MW of target protein)