CC2D1B Antikörper (C-Term)

Produktnummer ABIN630531

Produktdetails anti-CC2D1B Antikörper

Target: CC2D1B (Coiled-Coil and C2 Domain Containing 1B (CC2D1B))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CC2D1B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CC2 D2 antibody was raised against the C terminal of CC2 2

Aufreinigung: Affinity purified

Immunogen: CC2 D2 antibody was raised using the C terminal of CC2 2 corresponding to a region with amino acids IVRGMNLPAPPGVTPDDLDAFVRFEFHYPNSDQAQKSKTAVVKNTNSPEF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CC2D1B Blocking Peptide, catalog no. 33R-4207, is also available for use as a blocking control in assays to test for specificity of this CC2D1B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CC0 0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CC2D1B

Target: CC2D1B (Coiled-Coil and C2 Domain Containing 1B (CC2D1B))

Andere Bezeichnung: CC2D1B (CC2D1B Produkte)

Synonyme: MGC68887 antikoerper, fb71c02 antikoerper, wu:fb71c02 antikoerper, A830039B04Rik antikoerper, Freud2 antikoerper, RGD1306630 antikoerper, coiled-coil and C2 domain containing 1B L homeolog antikoerper, coiled-coil and C2 domain containing 1B antikoerper, cc2d1b.L antikoerper, CC2D1B antikoerper, cc2d1b antikoerper, Cc2d1b antikoerper

Hintergrund: CC2D1B belongs to the CC2D1 family. It contains 1 C2 domain. A function of Cc2d1b/Cc2d1a and their Drosophila homologue l(2)gd in D.melanogaster in Notch trafficking have been reported.

Molekulargewicht: 41 kDa (MW of target protein)