SQLE Antikörper (C-Term)
Kurzübersicht für SQLE Antikörper (C-Term) (ABIN630528)
Target
Alle SQLE Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- C-Term
-
Spezifität
- SQLE antibody was raised against the C terminal of SQLE
-
Aufreinigung
- Affinity purified
-
Immunogen
- SQLE antibody was raised using the C terminal of SQLE corresponding to a region with amino acids KKSFYWARKTSHSFVVNILAQALYELFSATDDSLHQLRKACFLYFKLGGE
-
-
-
-
Applikationshinweise
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
SQLE Blocking Peptide, (ABIN939879), is also available for use as a blocking control in assays to test for specificity of this SQLE antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SQLE antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- SQLE (Squalene Epoxidase (SQLE))
-
Andere Bezeichnung
- SQLE
-
Hintergrund
- Squalene epoxidase catalyzes the first oxygenation step in sterol biosynthesis and is thought to be one of the rate-limiting enzymes in this pathway.
-
Molekulargewicht
- 39 kDa (MW of target protein)
Target
-