CCDC46 Antikörper (C-Term)

Produktnummer ABIN630527

Der Kaninchen Polyklonal anti-CCDC46 Antikörper wird verwendet zum Nachweis von CCDC46 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für CCDC46 Antikörper (C-Term) (ABIN630527)

Target: CCDC46 (Coiled-Coil Domain Containing 46 (CCDC46))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CCDC46 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CCDC46 Antikörper

Bindungsspezifität: C-Term

Spezifität: CCDC46 antibody was raised against the C terminal of CCDC46

Aufreinigung: Affinity purified

Immunogen: CCDC46 antibody was raised using the C terminal of CCDC46 corresponding to a region with amino acids IEKEYTQKLAKSSQIIAELQTTISSLKEENSQQQLAAERRLQDVRQKFED

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CCDC46 Blocking Peptide, (ABIN939328), is also available for use as a blocking control in assays to test for specificity of this CCDC46 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC46 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CCDC46

Target: CCDC46 (Coiled-Coil Domain Containing 46 (CCDC46))

Andere Bezeichnung: CCDC46

Hintergrund: CCDC46 is a protein with filament, myosin tail and ATPase domains. Orthologs of the gene exist in mouse, rat and chimp.

Molekulargewicht: 23 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom