CRAT Antikörper (N-Term)

Produktnummer ABIN630518

Produktdetails anti-CRAT Antikörper

Target: CRAT (Carnitine O-Acetyltransferase (CRAT))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CRAT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CRAT antibody was raised against the N terminal of CRAT

Aufreinigung: Affinity purified

Immunogen: CRAT antibody was raised using the N terminal of CRAT corresponding to a region with amino acids MKASSRFKAHQDALPRLPVPPLQQSLDHYLKALQPIVSEEEWAHTKQLVD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CRAT Blocking Peptide, catalog no. 33R-6123, is also available for use as a blocking control in assays to test for specificity of this CRAT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRAT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CRAT

Target: CRAT (Carnitine O-Acetyltransferase (CRAT))

Andere Bezeichnung: CRAT (CRAT Produkte)

Synonyme: CAT1 antikoerper, AW107812 antikoerper, CARAT antikoerper, CAT antikoerper, Carnitine acetylase antikoerper, CrAT antikoerper, hm:zeh0248 antikoerper, zgc:92317 antikoerper, carnitine O-acetyltransferase antikoerper, carnitine acetyltransferase antikoerper, Carnitine acetyltransferase antikoerper, Carnitine acetyltransferase, putative antikoerper, carnitine O-acetyltransferase a antikoerper, CRAT antikoerper, Crat antikoerper, CNA05200 antikoerper, CNL05760 antikoerper, CC1G_06292 antikoerper, PAS_chr3_0761 antikoerper, CGB_A5470W antikoerper, CGB_D1240C antikoerper, crata antikoerper

Hintergrund: Carnitine acetyltransferase (CRAT) is a key enzyme in the metabolic pathway in mitochondria, peroxisomes and endoplasmic reticulum. CRAT catalyzes the reversible transfer of acyl groups from an acyl-CoA thioester to carnitine and regulates the ratio of acylCoA/CoA in the subcellular compartments. Different subcellular localizations of the CRAT mRNAs are thought to result from alternative splicing of the CRAT geneuggested by the divergent sequences in the 5' region of peroxisomal and mitochondrial CRAT cDNAs and the location of an intron where the sequences diverge.

Molekulargewicht: 51 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process