HBS1L Antikörper

Produktnummer ABIN630516

Dieses Anti-HBS1L-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von HBS1L in WB. Geeignet für Hepatitis B Virus (HBV).

Kurzübersicht für HBS1L Antikörper (ABIN630516)

Target: HBS1L (HBS1-Like (HBS1L))

Reaktivität: Hepatitis B Virus (HBV)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HBS1L Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-HBS1L Antikörper

Aufreinigung: Affinity purified

Immunogen: HBS1 L antibody was raised using a synthetic peptide corresponding to a region with amino acids MNHKILVCFADQGSGFCITGKIEAGYIQTGDRLLAMPPNETCTVKGITLH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HBS1L Blocking Peptide, (ABIN5613941), is also available for use as a blocking control in assays to test for specificity of this HBS1L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HBS0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HBS1L

Target: HBS1L (HBS1-Like (HBS1L))

Hintergrund: HBS1L belongs to the GTP-binding elongation factor family. The HBS1L-MYB intergenic region on chromosome 6q23.3 influences erythrocyte, platelet, and monocyte counts. HBS1L-related genetic variants play a key role in control of fetal hemoglobin levels.

Molekulargewicht: 22 kDa (MW of target protein)