ESRRG Antikörper (N-Term)

Produktnummer ABIN630513

Produktdetails anti-ESRRG Antikörper

Target: ESRRG (Estrogen-Related Receptor gamma (ESRRG))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ESRRG Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ESRRG antibody was raised against the N terminal of ESRRG

Aufreinigung: Affinity purified

Immunogen: ESRRG antibody was raised using the N terminal of ESRRG corresponding to a region with amino acids DRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ESRRG Blocking Peptide, catalog no. 33R-2143, is also available for use as a blocking control in assays to test for specificity of this ESRRG antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ESRRG antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ESRRG

Target: ESRRG (Estrogen-Related Receptor gamma (ESRRG))

Andere Bezeichnung: ESRRG (ESRRG Produkte)

Synonyme: ERR3 antikoerper, ERRgamma antikoerper, NR3B3 antikoerper, ESRRG antikoerper, USH2A antikoerper, DKFZp459J0417 antikoerper, err3 antikoerper, nr3b3 antikoerper, LOC100219115 antikoerper, errg antikoerper, errgamma antikoerper, esrrg antikoerper, errb/g antikoerper, esrrgl antikoerper, errbeta/gamma antikoerper, Errg antikoerper, mKIAA0832 antikoerper, estrogen related receptor gamma antikoerper, estrogen-related receptor gamma antikoerper, estrogen-related receptor gamma a antikoerper, estrogen-related receptor gamma b antikoerper, ESRRG antikoerper, esrrg antikoerper, Esrrg antikoerper, esrrga antikoerper, esrrgb antikoerper

Hintergrund: ERRs, which are coexpressed with ERs in prostatic cells, could regulate cell growth and modulate ER-mediated pathways via interference on ERalpha transcription in prostatic cells. Not only PNRC2 but also the corepressor TLE1 functioned as ERRgamma coactivator in a reporter gene analysis. Transcriptional activation by ERR3 can be ligand-independent.

Molekulargewicht: 51 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Retinoic Acid Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway