Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

Retinoid X Receptor beta Antikörper (N-Term)

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch Retinoid X Receptor beta in WB. Er zeigt eine Reaktivität gegenüber Human, Maus, Ratte und Hund.
Produktnummer ABIN630493

Kurzübersicht für Retinoid X Receptor beta Antikörper (N-Term) (ABIN630493)

Target

Alle Retinoid X Receptor beta (RXRB) Antikörper anzeigen
Retinoid X Receptor beta (RXRB) (Retinoid X Receptor, beta (RXRB))

Reaktivität

  • 43
  • 29
  • 26
  • 8
  • 8
  • 7
  • 5
  • 5
  • 4
  • 4
  • 3
  • 1
Human, Maus, Ratte, Hund

Wirt

  • 37
  • 7
  • 1
Kaninchen

Klonalität

  • 38
  • 7
Polyklonal

Konjugat

  • 28
  • 2
  • 2
  • 2
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Dieser Retinoid X Receptor beta Antikörper ist unkonjugiert

Applikation

  • 45
  • 16
  • 11
  • 5
  • 3
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Western Blotting (WB)
  • Bindungsspezifität

    • 7
    • 5
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    N-Term

    Spezifität

    RXRB antibody was raised against the N terminal of RXRB

    Aufreinigung

    Affinity purified

    Immunogen

    RXRB antibody was raised using the N terminal of RXRB corresponding to a region with amino acids PGFSGPVSSPQINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPPPGGPGA
  • Applikationshinweise

    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.

    Kommentare

    RXRB Blocking Peptide, (ABIN5615984), is also available for use as a blocking control in assays to test for specificity of this RXRB antibody

    Beschränkungen

    Nur für Forschungszwecke einsetzbar
  • Format

    Lyophilized

    Rekonstitution

    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RXRB antibody in PBS

    Konzentration

    Lot specific

    Buffer

    PBS

    Handhabung

    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.

    Lagerung

    4 °C/-20 °C

    Informationen zur Lagerung

    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target

    Retinoid X Receptor beta (RXRB) (Retinoid X Receptor, beta (RXRB))

    Andere Bezeichnung

    RXRB

    Hintergrund

    RXRB is a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the effects of retinoic acid (RA). This receptor forms homodimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements.

    Molekulargewicht

    57 kDa (MW of target protein)

    Pathways

    Nuclear Receptor Transcription Pathway, Retinoic Acid Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway
Sie sind hier:
Chat with us!