Retinoid X Receptor beta Antikörper (N-Term)
-
- Target Alle Retinoid X Receptor beta (RXRB) Antikörper anzeigen
- Retinoid X Receptor beta (RXRB) (Retinoid X Receptor, beta (RXRB))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Retinoid X Receptor beta Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RXRB antibody was raised against the N terminal of RXRB
- Aufreinigung
- Affinity purified
- Immunogen
- RXRB antibody was raised using the N terminal of RXRB corresponding to a region with amino acids MHCGVASRWRRRRPWLDPAAAAAAAVAGGEQQTPEPEPGEAGRDGMGDSG
- Top Product
- Discover our top product RXRB Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RXRB Blocking Peptide, catalog no. 33R-6089, is also available for use as a blocking control in assays to test for specificity of this RXRB antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RXRB antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Retinoid X Receptor beta (RXRB) (Retinoid X Receptor, beta (RXRB))
- Andere Bezeichnung
- RXRB (RXRB Produkte)
- Synonyme
- DAUDI6 antikoerper, H-2RIIBP antikoerper, NR2B2 antikoerper, RCoR-1 antikoerper, RXR-beta antikoerper, RXRbeta antikoerper, rxrb antikoerper, RXRB antikoerper, nr2b2 antikoerper, daudi6 antikoerper, rcor-1 antikoerper, h-2riibp antikoerper, NR2B2-A antikoerper, RXR antikoerper, RXRA antikoerper, etID309733.19 antikoerper, rxre antikoerper, wu:fb93c09 antikoerper, AL023085 antikoerper, Nr2b2 antikoerper, Rub antikoerper, rxrd antikoerper, unp286 antikoerper, retinoid X receptor beta antikoerper, retinoid X receptor beta S homeolog antikoerper, retinoid x receptor, beta a antikoerper, retinoid x receptor, beta b antikoerper, RXRB antikoerper, Rxrb antikoerper, rxrb.S antikoerper, rxrb antikoerper, rxrba antikoerper, rxrbb antikoerper
- Hintergrund
- RXRB is a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the effects of retinoic acid (RA). This receptor forms homodimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements.
- Molekulargewicht
- 57 kDa (MW of target protein)
- Pathways
- Nuclear Receptor Transcription Pathway, Retinoic Acid Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway
-