Retinoid X Receptor beta Antikörper (N-Term)
Kurzübersicht für Retinoid X Receptor beta Antikörper (N-Term) (ABIN630492)
Target
Alle Retinoid X Receptor beta (RXRB) Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- N-Term
-
Spezifität
- RXRB antibody was raised against the N terminal of RXRB
-
Aufreinigung
- Affinity purified
-
Immunogen
- RXRB antibody was raised using the N terminal of RXRB corresponding to a region with amino acids MHCGVASRWRRRRPWLDPAAAAAAAVAGGEQQTPEPEPGEAGRDGMGDSG
-
-
-
-
Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
RXRB Blocking Peptide, (ABIN5615983), is also available for use as a blocking control in assays to test for specificity of this RXRB antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RXRB antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- Retinoid X Receptor beta (RXRB) (Retinoid X Receptor, beta (RXRB))
-
Andere Bezeichnung
- RXRB
-
Hintergrund
- RXRB is a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the effects of retinoic acid (RA). This receptor forms homodimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements.
-
Molekulargewicht
- 57 kDa (MW of target protein)
-
Pathways
- Nuclear Receptor Transcription Pathway, Retinoic Acid Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway
Target
-