HNF4 gamma Antikörper (C-Term)

Produktnummer ABIN630491

Produktdetails anti-HNF4 gamma Antikörper

Target: HNF4 gamma (HNF4G) (Hepatocyte Nuclear Factor 4 gamma (HNF4G))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HNF4 gamma Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HNF4 G antibody was raised against the C terminal of HNF4

Aufreinigung: Affinity purified

Immunogen: HNF4 G antibody was raised using the C terminal of HNF4 corresponding to a region with amino acids QDPLTGQTILLGPMSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQAS

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HNF4G Blocking Peptide, catalog no. 33R-7508, is also available for use as a blocking control in assays to test for specificity of this HNF4G antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNF0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HNF4 gamma

Target: HNF4 gamma (HNF4G) (Hepatocyte Nuclear Factor 4 gamma (HNF4G))

Andere Bezeichnung: HNF4G (HNF4G Produkte)

Synonyme: HNF4G antikoerper, hnf4gamma antikoerper, zgc:153265 antikoerper, NR2A2 antikoerper, NR2A3 antikoerper, hepatocyte nuclear factor 4 gamma antikoerper, hepatocyte nuclear factor 4, gamma antikoerper, HNF4G antikoerper, hnf4g antikoerper, Hnf4g antikoerper

Hintergrund: HNF4 was first identified as a DNA binding activity in rat liver nuclear extracts and then was found to be an orphan member of the nuclear receptor superfamily. Binding sites for this factor were identified in many tissue-specifically expressed genes, and the protein was found to be essential for early embryonic development in the mouse

Molekulargewicht: 50 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway