EMP2 Antikörper (Middle Region)

Produktnummer ABIN630488

Der Kaninchen Polyklonal Anti-EMP2-Antikörper wurde für WB und IHC validiert. Er ist geeignet, EMP2 in Proben von Human zu detektieren.

Kurzübersicht für EMP2 Antikörper (Middle Region) (ABIN630488)

Target: EMP2 (Epithelial Membrane Protein 2 (EMP2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EMP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-EMP2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: EMP2 antibody was raised against the middle region of EMP2

Aufreinigung: Purified

Immunogen: EMP2 antibody was raised using the middle region of EMP2 corresponding to a region with amino acids IQLMSCLCVMIAASIYTDRREDIHDKNAKFYPVTREGSYGYSYILAWVAF

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EMP2 Blocking Peptide, (ABIN939502), is also available for use as a blocking control in assays to test for specificity of this EMP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EMP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EMP2

Target: EMP2 (Epithelial Membrane Protein 2 (EMP2))

Andere Bezeichnung: EMP2

Hintergrund: Epithelial membrane protein-2 (EMP2) is a member of the four transmembrane superfamily (TM4SF) and is thought to mediate trafficking of diverse proteins such as alpha6beta1 integrin and MHC class I to lipid raft microdomains. EMP2 has also recently been recognised as a putative tumor suppressor gene in certain model systems.

Molekulargewicht: 18 kDa (MW of target protein)