VSIG4 Antikörper (N-Term)

Produktnummer ABIN630478

Produktdetails anti-VSIG4 Antikörper

Target: VSIG4 (V-Set and Immunoglobulin Domain-Containing Protein 4 (VSIG4))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser VSIG4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: VSIG4 antibody was raised against the N terminal of VSIG4

Aufreinigung: Purified

Immunogen: VSIG4 antibody was raised using the N terminal of VSIG4 corresponding to a region with amino acids VPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVS

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

VSIG4 Blocking Peptide, catalog no. 33R-9726, is also available for use as a blocking control in assays to test for specificity of this VSIG4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VSIG4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu VSIG4

Target: VSIG4 (V-Set and Immunoglobulin Domain-Containing Protein 4 (VSIG4))

Andere Bezeichnung: VSIG4 (VSIG4 Produkte)

Synonyme: DKFZp468O0322 antikoerper, CRIg antikoerper, Z39IG antikoerper, A530061A11 antikoerper, BC025105 antikoerper, V-set and immunoglobulin domain containing 4 antikoerper, VSIG4 antikoerper, Vsig4 antikoerper

Hintergrund: T cell activation by APCs is positively and negatively regulated by members of the B7 family. VSIG4 is a strong negative regulator of murine and human T cell proliferation and IL-2 production.

Molekulargewicht: 44 kDa (MW of target protein)