ST6GALNAC5 Antikörper (Middle Region)

Produktnummer ABIN630476

Der Kaninchen Polyklonal Anti-ST6GALNAC5-Antikörper wurde für WB validiert. Er ist geeignet, ST6GALNAC5 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für ST6GALNAC5 Antikörper (Middle Region) (ABIN630476)

Target: ST6GALNAC5 (ST6 (Alpha-N-Acetyl-Neuraminyl-2,3-beta-Galactosyl-1,3)-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 5 (ST6GALNAC5))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ST6GALNAC5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ST6GALNAC5 Antikörper

Bindungsspezifität: Middle Region

Spezifität: ST6 GALNAC5 antibody was raised against the middle region of ST6 ALNAC5

Aufreinigung: Purified

Immunogen: ST6 GALNAC5 antibody was raised using the middle region of ST6 ALNAC5 corresponding to a region with amino acids AFMITRHKMLQFDELFKQETGKDRKISNTWLSTGWFTMTIALELCDRINV

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ST6GALNAC5 Blocking Peptide, (ABIN936553), is also available for use as a blocking control in assays to test for specificity of this ST6GALNAC5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 ALNAC5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ST6GALNAC5

Target: ST6GALNAC5 (ST6 (Alpha-N-Acetyl-Neuraminyl-2,3-beta-Galactosyl-1,3)-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 5 (ST6GALNAC5))

Andere Bezeichnung: ST6GALNAC5

Hintergrund: ST6GALNAC5 belongs to a family of sialyltransferases that modify proteins and ceramides on the cell surface to alter cell-cell or cell-extracellular matrix interactions.

Molekulargewicht: 38 kDa (MW of target protein)