TMEM109 Antikörper (Middle Region)

Produktnummer ABIN630474

Der Kaninchen Polyklonal anti-TMEM109 Antikörper (ABIN630474) detektiert spezifisch TMEM109 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für TMEM109 Antikörper (Middle Region) (ABIN630474)

Target: TMEM109 (Transmembrane Protein 109 (TMEM109))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM109 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TMEM109 Antikörper

Bindungsspezifität: Middle Region

Spezifität: TMEM109 antibody was raised against the middle region of TMEM109

Aufreinigung: Purified

Immunogen: TMEM109 antibody was raised using the middle region of TMEM109 corresponding to a region with amino acids GIAAQLLNALGLAGDYLAQGLKLSPGQVQTFLLWGAGALVVYWLLSLLLG

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM109 Blocking Peptide, (ABIN938708), is also available for use as a blocking control in assays to test for specificity of this TMEM109 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM109 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM109

Target: TMEM109 (Transmembrane Protein 109 (TMEM109))

Andere Bezeichnung: TMEM109

Hintergrund: The function of TMEM109 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 26 kDa (MW of target protein)