TOR1B Antikörper

Produktnummer ABIN630472

Produktdetails anti-TOR1B Antikörper

Target: TOR1B (Torsin Family 1, Member B (Torsin B) (TOR1B))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TOR1B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: TOR1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids VFNNKHSGLWHSGLIDKNLIDYFIPFLPLEYRHVKMCVRAEMRARGSAID

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TOR1B Blocking Peptide, catalog no. 33R-9534, is also available for use as a blocking control in assays to test for specificity of this TOR1B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TOR0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TOR1B

Target: TOR1B (Torsin Family 1, Member B (Torsin B) (TOR1B))

Andere Bezeichnung: TOR1B (TOR1B Produkte)

Synonyme: MGC82811 antikoerper, tor1a antikoerper, 2610016F05Rik antikoerper, DQ1 antikoerper, torsinB antikoerper, torsin family 1, member B (torsin B) L homeolog antikoerper, torsin family 1, member B (torsin B) antikoerper, torsin family 1 member B antikoerper, torsin family 1, member B antikoerper, tor1b.L antikoerper, tor1b antikoerper, TOR1B antikoerper, Tor1b antikoerper

Hintergrund: TOR1B may serve as a molecular chaperone assisting in the proper folding of secreted and/or membrane proteins.

Molekulargewicht: 38 kDa (MW of target protein)